PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G093800.1.p
Common NameCOL10, GLYMA_13G093800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 366aa    MW: 39873.8 Da    PI: 6.655
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G093800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.68e-062061338
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         ++ C+ ++   + lfC+ ++ +lC  C +++H        H+
  Glyma.13G093800.1.p 20 KKPCDSCKLASAALFCHLDSAFLCIACDSKIHCAnklasrHE 61
                         578******99********************95545666666 PP

2zf-B_box28.62.9e-0963108342
             zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                           ++C+ +e+ +++  C+ +   lC +C + +H+       H++vp+
  Glyma.13G093800.1.p  63 VWMCEVCEQAPASVTCKADAAALCVTCDSDIHSAnplaqrHERVPV 108
                          689*****************************66899999999986 PP

3CCT69.77.2e-24293336144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Glyma.13G093800.1.p 293 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 336
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.2E-81865IPR000315B-box-type zinc finger
PROSITE profilePS501199.7551865IPR000315B-box-type zinc finger
CDDcd000213.50E-62265No hitNo description
PROSITE profilePS5011910.93661108IPR000315B-box-type zinc finger
PfamPF006433.2E-763108IPR000315B-box-type zinc finger
CDDcd000213.87E-964108No hitNo description
SMARTSM003363.7E-1066108IPR000315B-box-type zinc finger
PfamPF062035.6E-18293335IPR010402CCT domain
PROSITE profilePS5101716.787293335IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGIERGGLKG FRSGWSVPPK KPCDSCKLAS AALFCHLDSA FLCIACDSKI HCANKLASRH  60
ERVWMCEVCE QAPASVTCKA DAAALCVTCD SDIHSANPLA QRHERVPVEP FFDSAESIVK  120
ASATASFGFV VPSDDGAASD VFAPDDSDSA AWLIPNPNFG SKLMDAPEIK SKEIFFSEMD  180
PFLDFDYSNS FQNHNSAVND SVVPVQTKPS LAPPPINNHQ HHHQSETCFD IDFCRSKLSS  240
FNYPSQSLSQ SVSSSSLDVG VVPDGNTVSD MSYSSGIVVS GGQGATQLCG MDREARVLRY  300
REKRKNRKFE KTIRYASRKA YAETRPRIKG RFAKRTEIDS DVERLYSPGA AALMLDTPYG  360
VVPTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.344410.0cotyledon| flower| hypocotyl| leaf| meristem| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ8642640.0GQ864264.1 Glycine max CONSTANS-like zinc finger protein (COL10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240941.10.0zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-125COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLD0EP050.0D0EP05_SOYBN; CONSTANS-like zinc finger protein
STRINGGLYMA13G01290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-114CONSTANS-like 5